DPCstruct | MC59536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 186 ± 21 aa |
| Standard deviation of domain lengths | 21.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0005 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0A239 | 486-635 | RGRCLCYSGRFICMKPPLGEYSLPGGVFLMLGYSSADEALLRPHTNLGVQDAVRALQQYVTTYIDNQTQCTLTLFNMTDENIIIAAR… |
| A0A183U289 | 39-203 | DLPDLGPGVYLLVGYSLDEVAMLKETVPKGVLERSGFVSEDNFVAHDIGSRLQIALERLMPHEVQCRIMFLDEFKSEGNIIFQMEWF… |
| A0A6V7TMH9 | 143-334 | None |
| R7TZA7 | 461-630 | None |
| R7U5X8 | 465-636 | None |
| T1FG53 | 223-375 | None |
| A0A6P7FSX3 | 932-1147 | None |
| A0A182VS72 | 611-806 | None |
| A0A6P5UG58 | 757-954 | None |
| A0A6J2JAX2 | 578-735 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.