DPCstruct | MC59531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Standard deviation of domain lengths | 13.88 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C9G6I6 | 67-194 | SVSSALREIIRNKEYNKQDLFAYKDLWHSPMHHGSFSAFTPEETLHAINSRLHHAYKKLPEFNWLMVTMGTAYVYRQKESGQVVANC… |
| A0A7S3F6T2 | 1-117 | QNLYFSYEAGTCCSSASADEMVAGLNRRVEAGHSSLIQSRCLFLTLGSAWAYALSNGNVVANCHRQPQQHFERVLLSPDAATQHILD… |
| B5JHD6 | 1-100 | None |
| B0NUX6 | 1-100 | None |
| A0A7R9UN48 | 4-123 | None |
| W4URS3 | 1-144 | None |
| A0A847IR77 | 1-110 | None |
| A0A6A8GVR7 | 78-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.