DPCstruct | MC59530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3F5J6 | 43-145 | KIAGLATYPGYCGFTNFMGDRRQRELACLVGTKGSFQLTAPTFETGLAECAALCRSCARCKYVSYTLKQTDCSWFHSCDLTSLHDAP… |
| A0A7S2C2G5 | 21-112 | RAAKWLGTSRDGYCQRTQDEGTCANGDKGSFSLAKELDWAAAAEACLNRCDQCARCRYISVSANFHDCSWFFTCNLARLQSDVPGFA… |
| A0A7S0HCT5 | 263-360 | None |
| A0A7S0J9T4 | 62-161 | None |
| A0A7S2JM13 | 2-92 | None |
| A0A7S2NG51 | 117-206 | None |
| A0A7S0DZE5 | 12-109 | None |
| A0A7S0EB26 | 351-456 | None |
| A0A7S0EP91 | 291-381 | None |
| A0A7S0HH17 | 35-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.