DPCstruct | MC59519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 87 ± 11 aa |
| Standard deviation of domain lengths | 11.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3Q6Z1 | 2-76 | LYIDLENEKKAQIICRTLAVDKEPSRSTAKRTYNVQGHHLVVEVVSLDAKYLQKSVDNLFDMCYLARQTIDEVTR |
| K0S2M5 | 3-100 | TKDDGVDRQYKCTIHLALPSAQCAQHLRDVISVDKEISDKVVKTISVVKSDEVVEGEEPSEARVLRIQFEATDAKMLRVSVSTTYDM… |
| A0A135RRK0 | 136-245 | None |
| A0A662TT08 | 1-86 | None |
| A0A0F8AGN6 | 649-728 | None |
| A0A7J7YDC4 | 152-239 | None |
| A0A183H1N6 | 11-100 | None |
| A0A2V0PJP5 | 26-114 | None |
| A0A2U3DQW2 | 392-495 | None |
| A0A4S4ELP6 | 62-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.