DPCstruct | MC59518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 233 ± 14 aa |
| Standard deviation of domain lengths | 14.21 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 51.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0RR45 | 1-198 | MGCSNLTEVTLAGKGYLAEGYLAEGFLDRGLLSGGGALNNNKINEMFGPGLSAFRGCGLTTIKIELSQRMARLPEECRRSVEGEVPD… |
| K0S0B5 | 1-248 | MTDVQLNVGLQVIGGHAFRDCTALRSVTIPSTVTELGQSAFHGCSSLSEAIFRGGERLLEQEFFARGLFSRERGLLNQGKLDNILYD… |
| K0R2A5 | 994-1228 | None |
| K0RND7 | 119-339 | None |
| K0R276 | 340-576 | None |
| K0SA81 | 225-465 | None |
| K0SKD6 | 512-754 | None |
| K0S7P0 | 125-363 | None |
| K0R0S8 | 64-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.