DPCstruct | MC59515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 531 ± 128 aa |
| Standard deviation of domain lengths | 128.25 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8H633 | 77-603 | TFNHIAFPPKLPGTRDAKVEVVEKDILTRLRTAVHITKAYSSDNDATSVWEGLEESLEICQFVNENSFINREAMESTLLSIKPHHTL… |
| A0A5M8PNI5 | 6-339 | NYIINHVFLPLKLPQKNDSDDAKGASLIEELRAALKSLQAHIPERERSEWIPCIKMVGNMLELRDQFGGLVAEKMEAMLRKMIDGDI… |
| A0A2U3E0R9 | 300-950 | None |
| A0A6A3XTG8 | 2-551 | None |
| A0A1L7UEL0 | 1-551 | None |
| A0A4R8TBG3 | 4-517 | None |
| A0A2J8AEL9 | 31-499 | None |
| A0A2H2ZLJ1 | 4-665 | None |
| A0A094ICD2 | 2-412 | None |
| J3PF70 | 18-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.