DPCstruct | MC59506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 106 ± 16 aa |
| Standard deviation of domain lengths | 15.74 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 69.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A0KZ22 | 4-108 | ATYVYRDDLTKKNHSPPSSSSSPQRQSKEIKKVKKRVRFVDTEPEEEELEDETEKNVRIMVKLKKQEANQMLSRCFNGGVLEFGDVT… |
| A0A2G9H8F0 | 25-112 | QYNYIYRDELNKKTAPLKVKKKVHFELERDQNEIENQVKSGIQLRVLMTKEEATKMLSKCKDGGILEFKDVASEIVRIPKNRVEIVCS |
| A0A4D9BK80 | 1-85 | None |
| A0A4D6LTD2 | 23-116 | None |
| A0A2P2P0E9 | 18-123 | None |
| A0A0L9TH98 | 9-125 | None |
| A0A7J6H2C1 | 1-139 | None |
| A0A1S3BS40 | 23-136 | None |
| A0A445KRV6 | 135-250 | None |
| A0A540M3F6 | 11-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.