DPCstruct | MC5950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 183 |
|---|---|
| Mean domain length (aa) | 141 ± 27 aa |
| Standard deviation of domain lengths | 27.14 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.63 |
| Pfam Score | 99.09 |
| Assigned Pfam label(s) | CL0029- CL0036- PF14736 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4HG03 | 1-120 | MPTITCIDDLQRLARRRVPRMFYDYVDSGAWTESTYRANANDFSSIGLRQRVMVDMSNRRLESEMLGERVSLPLALVPTGLTGSGHW… |
| A0A426SZT6 | 11-116 | PVDFINTYDLEPMAQKVIPKAAFGYIASGAEDTFTLRENIRAFNHKLIVPHTLRNVENPSTEIEFDGDKLSSPIILAPVAAHKLANV… |
| A0A819M6W2 | 54-184 | None |
| A0A1F7TAQ4 | 13-153 | None |
| A0A843WS97 | 47-134 | None |
| A0A7C0YHL7 | 8-163 | None |
| M9MJ45 | 459-630 | None |
| F5Y6G8 | 8-156 | None |
| A0A1V6RW97 | 1-138 | None |
| A0A291Q2V7 | 362-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.