DPCstruct | MC595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 259 ± 34 aa |
| Standard deviation of domain lengths | 34.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2FMI9 | 51-323 | DNRENGTVDNHNTISVKKVNIKSTTNLDDLAMKRNNSSDFPDTTYNKQNVINFSDNLLSLIKSIVFICIICYIITISMLLLYKKMEN… |
| A0A1Y3MKZ0 | 236-436 | KNIEKAHSLFLETLIIYPLFILLTIILAVIYFHVDNSEEKNIIQSKNGQWFYKCSLENLDIAYNALEIMILVMILIKGKYVIMIAIA… |
| A0A1Y3N3T1 | 1-269 | None |
| A0A1Y1VJZ0 | 456-773 | None |
| A0A1Y1VJY9 | 874-1167 | None |
| A0A1Y1WTK9 | 2-232 | None |
| A0A1Y3NHE1 | 184-460 | None |
| A0A1Y3N2Q1 | 116-361 | None |
| A0A1Y1V3L9 | 345-645 | None |
| A0A1Y2CL30 | 236-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.