DPCstruct | MC59491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 355 ± 23 aa |
| Standard deviation of domain lengths | 23.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K6G3W4 | 347-720 | AAAAAVWLSNITIGLHKDGYGMLLSNAMFGALKMYSHLATMDMDSDLLQVIPLVMLPAEKENATHEVVLAQKRELIHHIRDKPNEDI… |
| A0A0C3AWT7 | 1-361 | MLKLGFSKPGAAPCAAFVSHCVLGLDNAGYGSLLAEGVYSGVKMYAHLVTMSTPQTDFLIRTLVKLPCELVGDGDDLDLNEIRDLIE… |
| A0A4S8KL41 | 467-805 | None |
| A0A1J9RPZ9 | 573-948 | None |
| A0A2I2GMI9 | 538-906 | None |
| A0A397V2X7 | 251-592 | None |
| A0A5N6XTZ6 | 4-306 | None |
| A0A2I1CJF7 | 260-647 | None |
| A0A3M6T845 | 85-442 | None |
| F8P8Y2 | 405-752 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.