DPCstruct | MC59489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 190 ± 34 aa |
| Standard deviation of domain lengths | 33.54 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 93.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F0I5X2 | 1-179 | MFHVQSGLPIAGSPVHKVRAVFDLGLRHPSADKHPGLTHSWIHYLEMSATPAVALPAADRLRHLVPDVGHIHHMPTHLDVLIGDYRR… |
| A0A1Q5UBA8 | 108-316 | TPRGLWDLNTGKPTGDHTIEAREVIELRLKQDPGRSHPAICHLHIHMMEMSPFPELALPAADRLRGMVPHASHMLHMPTHIDAAVGD… |
| A0A2C6ANH6 | 1-127 | None |
| B8BRP2 | 849-1056 | None |
| A0A423WVK2 | 458-670 | None |
| A0A0F4GY58 | 701-912 | None |
| A0A1C3YN49 | 23-235 | None |
| A0A3E1K6A7 | 79-284 | None |
| A0A420S563 | 173-385 | None |
| A0A1Q7VGZ4 | 310-472 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.