DPCstruct | MC59487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 217 ± 13 aa |
| Standard deviation of domain lengths | 12.86 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B8IWW2 | 18-225 | NATAPVAQFVDHPQQQYGFDAFNEALPNDYPEVLLQDSIPYRVAWKSQLALGEPSAQADSISFAIKGISDPATLSLSTPLGNYPVAQ… |
| A0A357QPL4 | 169-384 | NIFTPVTISFFPPSPQNFGFDSLQFSALSGKYDKIRINKQDYFVPWKSVEVGSADHLAFNFIANTDSVFSGFSSDSVFFERLFTGER… |
| A0A1Q3ZEZ5 | 184-406 | None |
| A0A0S2HUX9 | 11-238 | None |
| A0A0S2HUV5 | 4-232 | None |
| A0A3D9KXW2 | 217-418 | None |
| L8K184 | 1-237 | None |
| A0A7C4IDU0 | 199-404 | None |
| A0A316KHJ9 | 20-211 | None |
| A0A7G5GWT8 | 190-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.