DPCstruct | MC5948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 79 ± 3 aa |
| Standard deviation of domain lengths | 3.09 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 94.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 57.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063- CL0106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A641VLR2 | 118-194 | PADVDVIMVAPKGPGTEVRRVFEEGFGCPGLIAVHQNPSGKARDVALAMAKAEGLTRGGVLECTMAQETYEDLFGEQ |
| A0A4R4GAG6 | 1-73 | MVAPKCPGTEVREEYKRGFGVPTLIAVHPENDPEGKGFEQAKAYAAATGGHKAGVLNSSFVAEVKSDLMGEQT |
| A0A381GWJ6 | 1-73 | None |
| A0A1U8N620 | 234-316 | None |
| A0A1Q9D3N5 | 307-388 | None |
| A0A2N0QMK8 | 13-92 | None |
| A0A2B4RLN9 | 446-527 | None |
| A0A699GJT4 | 790-869 | None |
| A0A3L7TLL3 | 140-215 | None |
| A0A7X6VLJ2 | 74-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.