DPCstruct | MC59472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 61 ± 6 aa |
| Standard deviation of domain lengths | 5.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5C9V1 | 13-76 | WLRDLFSTRDACRGGVIKRQVRDVERIVGRDVFLREVERRGRQALENGRHFIICCNAEPIRRVR |
| A0A238JTV2 | 7-62 | ARAAAEGGIVRRQSRDIDRIVGRDRFLAEVHKRGFHAVENAGQTVIFCNNHPVRIL |
| A0A2Z3R752 | 31-91 | None |
| A0A0J9GTS7 | 1-48 | None |
| A0A2R8BDI6 | 1-63 | None |
| Q5LV95 | 1-59 | None |
| A0A1X4NJ85 | 7-75 | None |
| A0A1M6ZT02 | 47-108 | None |
| A0A1X4NLG1 | 7-68 | None |
| A0A3D0G938 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.