DPCstruct | MC59464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 170 ± 35 aa |
| Standard deviation of domain lengths | 35.06 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.04 |
| Pfam Score | 20.83 |
| Assigned Pfam label(s) | CL0063- PF19919- PF19918- PF19921 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A3HYS8 | 12-155 | PSAPGPVTARGSAAVPVFALRWERREPPLPPAAVLALGDAVPALAAATRARLLAGVRLGTLADAGALLVLGAAGDLPWADGARYLGR… |
| A0A432MGQ1 | 128-271 | LVPGPIRWEPPSGAWEPVRLRLERDDRPRPASALLATAGALLPWAESAPTARLGALRAARSGDRVLVFGRRLPPIPGAGRLWGHRVL… |
| A0A6C2YMA2 | 215-423 | None |
| A0A512PEK3 | 10-151 | None |
| A0A2V8YT65 | 366-501 | None |
| A0A3G2G5J2 | 1-206 | None |
| A0A1V1NW63 | 1-198 | None |
| A0A428WI13 | 231-462 | None |
| A0A5Q3L7Z2 | 4-209 | None |
| A0A411WJK3 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.