DPCstruct | MC59462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 193 ± 15 aa |
| Standard deviation of domain lengths | 15.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 23.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A3HR07 | 28-213 | RAVLLDQDHFLNGWFDREAARTIGGLWLLAARSPRSLVHVPIRGNRPPESAAEGEPLDLVLLHHSLQFAPARWKELRARMGAGVPQT… |
| A0A1U1EDH2 | 109-314 | SVMKLHRHSVVLDARPYTIIRLRADAHVRFSTNNFHETWHVISDEPGAKTLARLLWGLAYQRLPGTLVLIDGRHLDTNPFDAEPTDP… |
| A0A223S780 | 2-188 | None |
| A0A372JM84 | 24-206 | None |
| A0A7G1KED7 | 2-190 | None |
| A0A1G6B0F5 | 1-223 | None |
| A0A3N1LW20 | 86-284 | None |
| A0A2W2DRE2 | 4-168 | None |
| A0A1H2APP4 | 10-200 | None |
| A0A539E174 | 65-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.