DPCstruct | MC5946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 8.27 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4G7T3 | 3-71 | VVDYKHKIGFEGTILLEPKPQEPTKHQYDYDVATVFSFLSEFGLQDEVKMNIEQGHAILAGHSFEHELA |
| A0A4U9KK69 | 208-292 | MKREQEHLAKFLHLSKDYARKNGFKGTFFIEPKPCEPTKHQYDYDSATVISFLRQYDLMDDFKLNIEVNHATLAGHTFQHELQVA |
| A0A1R3KAH3 | 949-1047 | None |
| A0A4Q2RG53 | 607-694 | None |
| A0A1D6MLF5 | 118-206 | None |
| A0A7E4S0R0 | 164-248 | None |
| A0A060WM71 | 2-71 | None |
| A0A6A5L3P0 | 697-784 | None |
| A0A2X3DHG8 | 2-81 | None |
| A0A498I6D4 | 286-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.