DPCstruct | MC59452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 293 ± 30 aa |
| Standard deviation of domain lengths | 30.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D2TB56 | 42-347 | FSPDIPEPTVTSLIRKILYPERVCNNDKNVVGIYRAKDITSSHPFYLRAVALKITHHISHIREVLIPAVSRALNELPWNYESYLGNV… |
| A0A7Y8BRI5 | 22-262 | AVRVSRGKVMARGVTELRKSYPEQASNFDLGHEFLRVALDEAVNKVSSDNLSHEYTALPRRILGSTESWQELKPVLLERFEGLRVAA… |
| A0A4R1NFX0 | 177-506 | None |
| A0A839VP04 | 229-473 | None |
| A0A2K4IIT5 | 82-377 | None |
| A0A7X1YA62 | 55-357 | None |
| A0A7X2BVT0 | 424-732 | None |
| A0A844C6N5 | 327-654 | None |
| A0A2T5DD26 | 138-423 | None |
| A0A848MUN3 | 71-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.