DPCstruct | MC5945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 187 ± 22 aa |
| Standard deviation of domain lengths | 21.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A828ZH33 | 14-207 | KEFDKTIGFDGDYIAIDTNLAKKQGATDSDIKLAISKVNEHNQIINDTLAIQPFVTYDENGFYFDEESARKENVSEDLIESTTKDFE… |
| A0A5C6WUD4 | 3-188 | VEKPAVRVGASARAQALDANPLGASIKKLDPYVTASSQGWKLDAPAKVLAQVPSADLQKLKTQIDKMNGYVKDGKIPAPKAASGASL… |
| U4TQL3 | 48-263 | None |
| H5SYQ4 | 40-260 | None |
| A0A1V8Q2D5 | 33-196 | None |
| A0A0Q4RCD1 | 44-259 | None |
| A0A0N0BPQ3 | 7-163 | None |
| A0A1I1Y4N7 | 12-162 | None |
| A0A653RA93 | 201-375 | None |
| A0A084ACV5 | 85-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.