DPCstruct | MC59448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 208 ± 24 aa |
| Standard deviation of domain lengths | 23.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q1AVN3 | 3-195 | DFISTKNLNFTFGNCKDCDANCCHGIYGTLFSQILKEEFVHVYKNFPILFIFGKELNFIKPVILLTNGIDKCPYLNDYKCSIYENRP… |
| A0A2E5AAX3 | 102-338 | NPEPLNPQEHQGKGLRYSDRQFDFLKETHFVPVTLGEFGAAGSRFPIIFLGENKTPVAAMGLQAGNNLFVNAETGEYEPYAYLPAFV… |
| A0A7C9IPB2 | 7-216 | None |
| D6SUZ0 | 1-177 | None |
| T0KC84 | 235-452 | None |
| A0A0C1GIS3 | 2-183 | None |
| A0A2G2BLK2 | 3-212 | None |
| A0A839IN26 | 6-207 | None |
| G7TJH0 | 1-175 | None |
| A0A850Q6U8 | 32-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.