DPCstruct | MC59432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 153 ± 35 aa |
| Standard deviation of domain lengths | 34.71 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7VWC7 | 56-196 | NSQAYNQFKSITGNKLLLKDLAQMSPHGQTYALEAFHSVLIDFAPKSQAFSPEGMLAKTRLAILHFNENSNRCQAVTREGKPRWSVV… |
| A0A6P4YF29 | 23-150 | TKASVKLSAIITKKSLLKDIRKLSPKYQTAHLEAFHSTINHFAPKWAAFFYMGMLSRLHLAALHHNENCGRGQARNKDGERIYKIRY… |
| K1PJU1 | 8-156 | None |
| K1PYL7 | 73-182 | None |
| A0A6P8URQ1 | 100-239 | None |
| B7P5P4 | 128-262 | None |
| V4B4D2 | 1-71 | None |
| V4AMD7 | 332-416 | None |
| A0A4X3PG11 | 508-693 | None |
| A0A4X3PR30 | 617-818 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.