DPCstruct | MC5943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 159 ± 6 aa |
| Standard deviation of domain lengths | 6.23 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A417U1V6 | 31-182 | MAKTELIPEMPKKTELVSKYPRLADIYNKMEKQNKVICQRDQQLASVEKEIAVTKGIFKGKQRKELQEQAEQLMIQIANMKQYLSSI… |
| A0A4V2SDC7 | 1-168 | MIFKFKLPPKSVPKIDLQEWNEMRTLMEKLQKQSQAMKFAQQEISSLKKQLSETTGFFKGKARKSLEGKIEQSEKQEKRIYTDMEQT… |
| A0A1C6IYL4 | 1-152 | None |
| K1UQ76 | 167-332 | None |
| A0A0J8YYD4 | 212-369 | None |
| A0A373IQI9 | 278-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.