DPCstruct | MC5942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 249 ± 20 aa |
| Standard deviation of domain lengths | 19.82 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2LA46 | 8-296 | LTNARKDELDEYLKRNYPENYISGEQDCNLLLWGKNGTEPKMFSLNIGVEYSPLEGLKGKTIGDIMNQKYQSNSSFKRLMKYGEEIS… |
| A0A374WIA1 | 33-282 | DLLSGSNTFGLTFDFFIDWAINRISPYVWIKRILLPTYTYDEFIGKLDSEMEKEFGKDYLCRLGRFATEYDMQVQFIVFHDELDWAN… |
| A0A377KWS6 | 3-248 | None |
| A0A1I7KED8 | 48-302 | None |
| A0A1J8PGI4 | 7-226 | None |
| A0A380K1Y5 | 2-256 | None |
| A0A653W3P1 | 1-279 | None |
| A0A7Y2QGD0 | 1-208 | None |
| A0A413W7C5 | 27-290 | None |
| A0A6P2CLX1 | 9-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.