DPCstruct | MC59419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 227 ± 36 aa |
| Standard deviation of domain lengths | 35.79 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M9VIS8 | 22-288 | ADDYDPTLFDVTAELSATGGAFQDFTFERLEEDFRYDRHLAGYGTNCTVTRVDESTLRTDYLPTYRQQRYVTRDPESFDPEIDTRFE… |
| A0A1I5RPG0 | 1-136 | MAGVTFGMDALADLARGDGAALQGALAPLVVAYGDWSAGQRTAAAAPDIAGAAQRGRTAATLIAAQDDARARIAAGIALLADARVQM… |
| A0A344UU85 | 171-408 | None |
| A0A5P8WGC9 | 274-542 | None |
| A0A381KJH1 | 291-547 | None |
| A0A350Y0D0 | 1-177 | None |
| A0A4D4KFZ5 | 263-528 | None |
| A0A439S4R6 | 242-483 | None |
| A0A3S4I1S0 | 5-253 | None |
| A0A178K3B5 | 231-447 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.