DPCstruct | MC59413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 185 ± 20 aa |
| Standard deviation of domain lengths | 20.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EXH1 | 8-215 | CDGIDLHFMEDSNSDEDDWIRSAPVKFISNDISFRNRLKRFFLRNPSTRLGSRIFDLVIKFLLCFLYIIRVELDDPQSYACGGRDCS… |
| A0A1Y2BF83 | 1-165 | MKHLSEASQSGSRSFAKLKLLFDIRTYFNLLRVFLTSEIFQVIVALLDLVCDVFFCVLYVINIQHALNHMDEIPLTLPGPSWLWVAR… |
| A0A3M0IXS9 | 128-311 | None |
| A0A026WY47 | 56-248 | None |
| A0A1A9X3G3 | 16-172 | None |
| A8DY93 | 95-273 | None |
| A0A1A8LM71 | 8-210 | None |
| A0A813W4T0 | 6-200 | None |
| A0A6Q8PFS3 | 10-174 | None |
| A0A4S2KWM9 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.