DPCstruct | MC59409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 172 ± 25 aa |
| Standard deviation of domain lengths | 25.36 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EK35 | 2-165 | NALKFYLSTSKYVMQANFADRDSWSELYRYLPYLRQALSCCVCRNIVKNPMGPSHKVCQHFVCKECVEKPMTIKPQCSWCKKRESFE… |
| A0A4Z2BW28 | 1-146 | MNPVNATSLYVSASRSVLQCDPRDPRALAELCKLLPFFRQSLSCLVCGNLLQDPIAPTDSSCQHYVCRGCKGQRMQLKPSCSWCKDY… |
| A0A7J5Y8A4 | 26-190 | None |
| A0A369RXD3 | 9-156 | None |
| A0A3Q0IQV9 | 3-185 | None |
| A0A182U8B1 | 1-206 | None |
| A0A182FMF0 | 4-208 | None |
| A0A401SBV2 | 48-187 | None |
| A0A7R9FPH2 | 4-190 | None |
| A0A7J7J1X5 | 1-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.