DPCstruct | MC59408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 255 ± 39 aa |
| Standard deviation of domain lengths | 39.00 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04147 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EK04 | 5-243 | LGNVNMGKQKKKNIADKVRNKRKESEKKINPFEVKINRQKHDVLGRKISKHDRGMPGLSRSKAIKKRKDTLLQEYGQRLKSNKFVDK… |
| A0A821R9A6 | 1-297 | MAKVKNKRNAGLADKVHRKKSEGVKKKLNPFEVHINKEKLKVLGKKSKHDRGLPGVSRAKAIQKRKETIGTEMKLLNKTNTFIDRRI… |
| A0A7R9I1E9 | 2-272 | None |
| A0A814DMS3 | 4-250 | None |
| A0A6A4WDX2 | 1-196 | None |
| A0A0B2V7Q9 | 1-297 | None |
| A0A4Z2BJ15 | 1-273 | None |
| T1KZ54 | 8-195 | None |
| A0A4V1IQ63 | 76-243 | None |
| A0A2U1JFQ3 | 393-649 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.