DPCstruct | MC59407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 456 |
|---|---|
| Mean domain length (aa) | 124 ± 23 aa |
| Standard deviation of domain lengths | 23.44 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.03 |
| Pfam Score | 82.62 |
| Assigned Pfam label(s) | PF16211- CL0012- PF02519- CL0219- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EHD9 | 12-152 | TGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIKNSLPEIGPLLRKGNYAERVGAGAPVYLAAVLEYL… |
| A0A3B6LW24 | 2-67 | GAPVYLASVLEYLAAELLELAGNAAKDNKKSRIIPRHLLLAIRNDQELGKLLAGVTIAHGGVLPNI |
| A0A1B0BLL3 | 1-94 | None |
| A0A318YEX6 | 238-378 | None |
| A0A6A6L7P4 | 35-166 | None |
| A0A4S2N8G9 | 85-224 | None |
| M1UPI1 | 124-270 | None |
| A0A0R3URE0 | 7-95 | None |
| A0A1E4SMZ6 | 3-124 | None |
| A0A2G3CTN0 | 5-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.