DPCstruct | MC59405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 258 |
|---|---|
| Mean domain length (aa) | 111 ± 19 aa |
| Standard deviation of domain lengths | 19.13 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 20.49 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | CL0041- CL0431- CL0093- CL0661- PF00643 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EBN6 | 36-150 | MDKKDKRTLLQCRTKLVEDLDVQPVLDHLFEAGILTADQVERISGNDTSARKNRALIDILPRRGPTAFKCFLESLINSDQSHLNAYL… |
| A0A7R9FT54 | 206-290 | PHQNAITSNWKDLIADMDVESVENYMIIKNKLPLDKREELKMEKVARRRRSLLLHYVHDRDEDVFLAFRDGLVDADQTHLAEKLK |
| C3ZGJ7 | 1-95 | None |
| A0A2B4S546 | 57-186 | None |
| A0A2B4S753 | 1-97 | None |
| A0A2B4S6M9 | 284-383 | None |
| A0A2C9KEH7 | 1-119 | None |
| R7UHF9 | 1-117 | None |
| A0A2R2MQ83 | 402-500 | None |
| R7UQK2 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.