DPCstruct | MC59404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 88 ± 14 aa |
| Standard deviation of domain lengths | 14.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8EBG9 | 8-82 | SQVYWRNQAKDELQKYLKSQKIEKVARNVIFFLGDGMSIPTITAARIRQGQLNNKTGEENVLSWEKFPHTNLLEL |
| A0A444SMA1 | 50-129 | ENEDSFWFSEAEEELKRALSRRFNTKTAKNVILFLGDGMGITVSTVGRIYKGQKKGFSGAEEYLAWEKFPDVSLIKTYNV |
| A0A4Q0IV21 | 14-113 | None |
| A0A2G8LFA1 | 2-71 | None |
| A0A2G8LDM5 | 14-101 | None |
| A0A6P8GWB3 | 18-97 | None |
| A0A7C6FLK4 | 2-113 | None |
| A0A2C9JPL6 | 23-102 | None |
| A0A0Q4IM14 | 2-65 | None |
| A0A6L5CPX3 | 5-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.