DPCstruct | MC5940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 145 ± 17 aa |
| Standard deviation of domain lengths | 16.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02600 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521GZZ7 | 130-252 | AFSWLALAQSVALVAVAGSFALTYALGLKPCPLCFYQRSFAMAVLAIVMLGRMLRVPSAAVTGMALAPAVAGLGVASYHVFLVHTRV… |
| A0A0J7JRQ9 | 121-278 | SLRREQRLLTLLSFICLGLVGGALYLQFVHGEDPCPLCIIQRYFFVLIAVFAFLGAGFNNWRGIALLERLVAISALGGLITAVRHIF… |
| A0A522CZG8 | 7-169 | None |
| A0A6L7VLJ2 | 6-158 | None |
| A0A2E3RFN4 | 7-166 | None |
| A0A838ZYH7 | 12-155 | None |
| A0A2D8RF02 | 22-201 | None |
| A0A3B9VI11 | 9-192 | None |
| W4SNR9 | 2-137 | None |
| A0A2M7SZ16 | 53-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.