DPCstruct | MC594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 635 ± 74 aa |
| Standard deviation of domain lengths | 74.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0389 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8WTL4 | 5-529 | KKFVLTETFEKLSTIKEDELITCLPREHFDIPWAISIKKLDGNFYVYLCCEKELGYPSNWSIEYKSTIQIMKPGGMGVSRNCKGIFD… |
| A0A1Y2FE92 | 139-812 | ESQEKLQHEPVPPHLEQSPVQSPVQIPVSTTERDKFINKLKGLLKNVTKKEYPTLEEKFIELEIENWDQLKDLKYSPEYVIGDNKWR… |
| A0A1E5VPH5 | 12-685 | None |
| A0A0E0R0E9 | 95-726 | None |
| A0A0D9XKN3 | 8-610 | None |
| A0A6A5DS03 | 1-631 | None |
| A0A7J8Q788 | 14-653 | None |
| A0A1Y1WY84 | 8-830 | None |
| A0A6P7VGV5 | 413-1083 | None |
| A0A438CWF4 | 2-707 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.