DPCstruct | MC59399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 844 |
|---|---|
| Mean domain length (aa) | 124 ± 24 aa |
| Standard deviation of domain lengths | 24.40 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.09 |
| Pfam Score | 84.90 |
| Assigned Pfam label(s) | PF09388- PF13788- CL0237- PF02875- CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2BYV9 | 25-134 | YKPRQPNMEITEEKSNDVSIIALNGRLNVTTTADLEKAFNKLFDENCTKILVDCRDLEYISSAGLRVLLAAAKQFKKISGEIALSGL… |
| A0A3B8V839 | 344-465 | TPPLPDHHATSLVEITRQGGILLVKPAGPSIGQREAPIIQEAVTPYIEEMGKSLDHLVMDLSGVTFMSSMGLGMCISLRNGAVAVKS… |
| A0A7S4R6L0 | 119-240 | None |
| A0A4Q4KF71 | 6-125 | None |
| A0A0S8BHB0 | 95-249 | None |
| A0A220UMF1 | 2-95 | None |
| A0A426TR84 | 433-555 | None |
| A0A4V5NI77 | 1016-1196 | None |
| A0A7S4RA56 | 562-679 | None |
| A0A7Z0GJD7 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.