DPCstruct | MC59395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 234 ± 55 aa |
| Standard deviation of domain lengths | 54.93 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18897 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7B5M8 | 2-161 | FLKFTKGDWTLGEEAKRVPEGATFVANLEEYYRGWVRWSDGKPTDHLIGRVIDRHRVPAREELGDLDESKWETEPNGARRDPWARTS… |
| A0A1F7X285 | 9-236 | ITRIKGLSDRRRLPRLDSIRLGIKKKSAKTGAEYPCEVDYFVVPDKIKEIYGDKPISLDVMIPINEIDAVFPAAYKYYGSSRGLICQ… |
| A0A7X7FKG1 | 1-169 | None |
| A0A356KZA6 | 80-318 | None |
| A0A7V9TAC5 | 14-205 | None |
| A0A1V5X7W2 | 14-245 | None |
| A0A192A7I7 | 8-308 | None |
| A0A1F9PD47 | 40-260 | None |
| A0A2W1Q292 | 3-151 | None |
| A0A3D0SU36 | 1-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.