DPCstruct | MC5939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 77 ± 13 aa |
| Standard deviation of domain lengths | 13.17 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20008 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1AXF9 | 3-77 | PNTDKIDEAVLALLHLTSYYEGKPEDTLPRAWKSHDWEALNRLHEKNLISNPKSKAKSVLLTEDGERLSKELFEK |
| A0A0J7JNU0 | 6-78 | IDTAAVDEAVLARLRLRLHGQNHAWKSFDWDVLNRLYEPGMIGNPVNNAKSVVLTEEGLRESECLFNQLFPSP |
| A0A3M3YN35 | 2-56 | None |
| A0A2T0KKH7 | 1-77 | None |
| A0A2J0YSS1 | 3-58 | None |
| A0A7W2KMS9 | 1-64 | None |
| A0A259TUF7 | 1-96 | None |
| A0A6I1GE89 | 14-103 | None |
| A0A1Q4R423 | 160-264 | None |
| A0A7W8UI46 | 36-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.