DPCstruct | MC59386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 108 ± 7 aa |
| Standard deviation of domain lengths | 7.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03419 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5WQ44 | 58-163 | MTVYVEYAFLDNFTMDCLLLFFACVTLKISFKWWRMALGAFVGTVCALATVYVSGFWSYVAKAACLFLMCVTTVGFGKKLFWHILLT… |
| A0A417GNZ0 | 8-108 | YTLYLDVIFLQNFLMNVFVLTLTGRMMRQTCRAGRIAAGGAAGALWACGGIFLPLSFPMKAALTCGPVSLLMVFLAFRERHPVRLLK… |
| A0A1M6NHU2 | 3-109 | None |
| A0A0B0HWW0 | 3-111 | None |
| A0A3R7ADV0 | 3-129 | None |
| W4RRP0 | 1-111 | None |
| A0A398CSP3 | 60-168 | None |
| A0A2N2CVA8 | 41-141 | None |
| A0A1W6WCD2 | 74-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.