DPCstruct | MC59385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 171 ± 17 aa |
| Standard deviation of domain lengths | 16.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5XVA5 | 3-171 | YQSMSGDAGEGTGTFTAKNSTLKIDSDSEYYSSAPFFFITNTNAVINLENNNIEYGSNILLKAAATTEWGKTGSNGGVVTLNASNQK… |
| A0A1V6A4X5 | 89-244 | IYQSMSGDAAVGSGTLTVNGGTLTVQEGPVFYSTNTVGVINLKGAKISGSSGILLKAGADQWGNPGSNGSDITINADSQKLNGNIVL… |
| A0A1V6TPY4 | 271-430 | None |
| A0A847Y0K5 | 542-703 | None |
| A0A4T0WF98 | 1-196 | None |
| A0A133ZDF5 | 100-267 | None |
| R5YTC6 | 1-148 | None |
| A0A316RSH3 | 152-330 | None |
| I7LFR9 | 33-214 | None |
| R6YN62 | 335-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.