DPCstruct | MC5938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 4.60 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0RYR5 | 74-151 | KVEQITFSGDYANKTGQPVMYITERAIFELRKDGVYLIEIAPGIDMQKDVLDQINFVPKMDGEPALMDWRVFRDELMG |
| A0A0J7JNS3 | 2-79 | QLNIAHSADAMRSNAGQAVFYITERCVFELTEEGLALTEVTPGIDIERDIASQMDFRPVMKRPPRHIDERIFIDSPMG |
| G9YHM1 | 132-211 | None |
| A0A536BRS9 | 205-282 | None |
| A0A238J544 | 282-352 | None |
| A0A844AVS4 | 128-207 | None |
| A0A7S3PPC5 | 210-288 | None |
| A0A645JLG7 | 1-84 | None |
| W0ITE7 | 9-90 | None |
| E0E126 | 28-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.