DPCstruct | MC59379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 133 |
|---|---|
| Mean domain length (aa) | 186 ± 28 aa |
| Standard deviation of domain lengths | 27.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.11 |
| Pfam Score | 83.75 |
| Assigned Pfam label(s) | CL0737- CL0056- CL0159- PF07589- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1SLG7 | 3-153 | FASSTEQTGALGGLSGADTICNNLASSASPALEGTFAAWLSNSTTDARDRIPNAVFKRVDGATVADNLADLTDGTIDNRINLNENGL… |
| A0A1M3NFT6 | 44-235 | ETAPDAAAHDDAAPSQVEKDAGDAGDAGVGDKRVFVTSTAFNGIMGGVAGVDARCIAAADREGLGGDWVAWISADGKNAIDRITHDG… |
| M6JIL2 | 55-261 | None |
| A0A0D2N036 | 261-423 | None |
| A0A1J4RL12 | 104-267 | None |
| A0A2H6BQJ1 | 21-222 | None |
| A0A7Y2GPL8 | 2-170 | None |
| B0S8G4 | 1441-1635 | None |
| A0A4Q5L678 | 156-322 | None |
| A0A534W8G6 | 403-585 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.