DPCstruct | MC59375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 352 |
|---|---|
| Mean domain length (aa) | 372 ± 65 aa |
| Standard deviation of domain lengths | 65.27 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.72 |
| Pfam Score | 98.17 |
| Assigned Pfam label(s) | CL0220- CL0016- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3N4M8 | 33-383 | LPKFELTLDEQAMTILSATTRENKSTWVHGSFKFGTIVFADVGVRAKGGTTFRALPAKSSLKVKLNKWVKGQKLYGLEELTLNNNVV… |
| A0A7C6SP42 | 16-327 | DKYFRAALFEDRPFEEYKSFVLRVSGNDCVWTRMADGIQSRLVDKIADTTVVHQAWRPVIVYLNGQYWGHYNLRERVSRYFVAQHEG… |
| A0A1Y1VLB1 | 89-396 | None |
| A0A1Y1VM20 | 118-540 | None |
| A0A5Q4G7A8 | 574-967 | None |
| A0A1Y1VBP8 | 634-1136 | None |
| A0A1Y1UZ99 | 2-300 | None |
| A0A7V8YE12 | 138-508 | None |
| W0EPN4 | 9-377 | None |
| A0A7C8D4M9 | 2-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.