DPCstruct | MC59372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 149 ± 31 aa |
| Standard deviation of domain lengths | 30.99 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16694 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3MUU9 | 19-176 | VGVSNKAPGGASARDAGDAAPIDGALALPAGYRTTFTKLNKTRFVSQGHASGRWEVDVWANELAQKALASRAREVPPGAIVVQEHYE… |
| A0A2H5X964 | 2-79 | PDGSVIAAAFYEAKDENGMCVAGDKKFVAVMVKDSKRYAKTGGWGWQAWDATGKPLVTDPTNQCVGCHFKVRDRDLVF |
| A0A3M1EQ23 | 13-173 | None |
| A0A535AF21 | 169-322 | None |
| A0A6L9J045 | 27-200 | None |
| A0A6L9J3W9 | 78-192 | None |
| A0A1F5IV24 | 29-182 | None |
| A0A4Q5X5D2 | 27-175 | None |
| M1WW29 | 4-100 | None |
| A0A1Q7CQT1 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.