DPCstruct | MC5937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 173 ± 32 aa |
| Standard deviation of domain lengths | 31.90 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.10 |
| Pfam Score | 82.65 |
| Assigned Pfam label(s) | PF05603- CL0548- PF21057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4AE41 | 6-158 | YLGLFFNEAYDHIRKVCIFLINNFSLPADKAFVVYIQSPESPYLFCKAVTVSHPSAILTLPWPKLRGQFQLNTNVVSLLAKIKVSME… |
| A0A388K781 | 384-563 | MFGVVFPGKSSVLDATRFVQVDQAHWVLDLNSLVGPAYEQIIEICIFLPNGTLLPADAALAVYVKAPGSSWEYRGAVSNARPSAVLP… |
| Q5BGY1 | 147-353 | None |
| A0A4T0JIN8 | 540-708 | None |
| A0A6A5R0Z6 | 961-1160 | None |
| D3BIE2 | 2-161 | None |
| A0A2A9P276 | 38-185 | None |
| A0A5D3DY50 | 10-171 | None |
| L8GWZ3 | 12-170 | None |
| A0A4X2KF77 | 106-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.