DPCstruct | MC59367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 131 ± 24 aa |
| Standard deviation of domain lengths | 24.25 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 91.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16571 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839QF01 | 1-119 | MLPLNEKQIRSSFLNASLRERKAITLPTGFDELEWDALDFLGWRDEKIPAFGYVVGEVDGAPVGVLMRQIDGKTRNRPQCSWCEDVN… |
| A0A810NUC3 | 1-118 | MTEAQIRRAMSNCSRGDASAMTLPKDFAERDWPSLTFLGWRDPKLDQRGYVLRWRDGRPVGLLLRAAGSSMSRGRAAMCLLCQAVRT… |
| A0A2W1WGJ3 | 201-359 | None |
| A0A5F0G6E0 | 2-148 | None |
| A0A1L8WMA1 | 134-258 | None |
| Q3ETZ1 | 1-104 | None |
| A0A1G6WHZ4 | 1-90 | None |
| A0A0R2JPG5 | 89-214 | None |
| A0A5Q2MFW9 | 1-161 | None |
| N0APW7 | 41-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.