DPCstruct | MC59365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 11.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3HF44 | 23-138 | QLFFRSFQFGLPILFTMSDRKVYIGYVTEIRSQPFNDVHVIPIVSGHRDRSNLRLVPVTPYQDIIHDVENDATEELDFEAFTVTLPI… |
| A0A2V0Q510 | 2-86 | ITMEDRKVYVGYIMDVGAPTEVTGVNQEILLIPTVSGYRDKDTLKVVYTTDYPSDTPLRPIGFRQENIVSISVFSEEVREAFKRV |
| A0A7Y0SI76 | 98-221 | None |
| A0A291QQ34 | 147-262 | None |
| S7XM25 | 126-218 | None |
| A0A845X725 | 15-121 | None |
| A0A7C1MWZ9 | 3-109 | None |
| A0A1F5IT67 | 70-193 | None |
| A0A7W5HH06 | 5-106 | None |
| A0A1H6B2A9 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.