DPCstruct | MC5936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 156 |
|---|---|
| Mean domain length (aa) | 109 ± 15 aa |
| Standard deviation of domain lengths | 14.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.40 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF00786- CL0231 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4A5L9 | 9-116 | RKPNKDVSLQELRDRLAEFAEARGWDQYHSPRNLLLALVGEVGELSEIFQWKGEVARGLPNWTSADKEHLEEELSDVLLYLVRLADV… |
| A0A327Y2K5 | 1-72 | MKHLQQKIIAFRDARNWRQFHNPKDLAISLTLEAGELLENFQWKTSEEAVQANFENIKDELADVVIYALLLS |
| C1N020 | 161-280 | None |
| A0A3Q9HRJ2 | 1-102 | None |
| A0A5A7RZ63 | 1-77 | None |
| A0A2Z3JUF3 | 1-105 | None |
| K3X2M1 | 104-228 | None |
| F0RTE2 | 68-172 | None |
| A0A6L6IZ44 | 42-165 | None |
| W7DV43 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.