DPCstruct | MC59358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 76 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 48.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094FT49 | 3-70 | APAPRTPPLDPSKCNSTVETMRCSRCAMSAETVSHNGRDVSADDARAGGMVKFGHNLYYCDRCAKIVG |
| W9Z0D0 | 2-56 | DSIQLPIASVEVFRCMRCARSVEATSTDDIGAMGMVRIAHNLYYCERCAKMVGYI |
| A0A0F7ZF31 | 25-101 | None |
| A0A6P8AN10 | 103-174 | None |
| A0A0G4LF32 | 261-334 | None |
| A0A0P7BA68 | 1-77 | None |
| F0XMF7 | 7-74 | None |
| A0A218Z5T5 | 212-311 | None |
| A0A177A2N5 | 1-70 | None |
| A0A6V8R9Q8 | 2-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.