DPCstruct | MC59354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 113 ± 13 aa |
| Standard deviation of domain lengths | 13.08 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 51.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2IUH4 | 2-120 | ECKGLEFQDVLLYDFFGKSPIKSEWEVIYGYMKDRKLPAPPRHFPCFNKLKRNTLCYELKQLYVAITRTKQRLWILDKGLPHSLFYY… |
| A0A287J830 | 395-504 | CKGLEFQDVLLYNFFGSSPLRNKWRVLYGYMKDKDIIAHSEEISHPGFDRTKHYLLCSELKQLYVAVTRTRQRLWICENTENYCRPM… |
| A0A067KC60 | 218-325 | None |
| A0A0P0WE98 | 1325-1436 | None |
| A0A2I0IB16 | 51-157 | None |
| A0A1R3HQH9 | 199-310 | None |
| R1BPP2 | 27-154 | None |
| K1PSJ0 | 890-1045 | None |
| A0A6P8D6V8 | 415-521 | None |
| A0A453L8X3 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.