DPCstruct | MC59351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 8.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4TN39 | 57-133 | EFAYKEALRQGDYGTLTVYFIRHPNFNALGYRNFPGKFGESSTDFIVDGCIIDAATMPGGRAAPYNLGGTVPHEVGH |
| A0A139H2Y4 | 28-104 | ERAMKTALKRGSYGELDLYFTTDIPNRILGWCNLPVPSPSSSELILDGCVNLADSMPGGTAAPFNLGATAIHEIGHW |
| A0A512DFZ4 | 169-245 | None |
| E3QH15 | 150-259 | None |
| A0A074Y1K8 | 88-167 | None |
| A0A4U0WBS8 | 2-77 | None |
| A0A2I0RR66 | 609-685 | None |
| B8LE86 | 100-173 | None |
| A0A5N5QDP5 | 157-234 | None |
| A0A7S8DBS1 | 116-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.