DPCstruct | MC5935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 323 |
|---|---|
| Mean domain length (aa) | 143 ± 27 aa |
| Standard deviation of domain lengths | 26.76 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 12.18 |
| Pfam Score | 98.96 |
| Assigned Pfam label(s) | CL0255- CL0293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A017SUI2 | 4-122 | RSVACTLINQTGEILSFADAALDHGIFTPQQAPPPVCEGSASWSGESDGFMTGTEGRVVYRGSSGAVTLYWDNPFVGGNEYGATSSG… |
| A0A6P4A0I4 | 2-144 | ASDNQYTFVQLCNATGCTLIYTGQIDWHGGIGPAPYPQSIANGEQGWFLHVRSASQPGSEGAVCYRGVDTNRTEFIWIVYWINPFNS… |
| A0A839IW99 | 1-136 | None |
| N4W209 | 60-225 | None |
| A0A385SU06 | 2-118 | None |
| A0A5B6WEN2 | 3-172 | None |
| A0A5N6PSD1 | 238-396 | None |
| A0A061D9Q8 | 176-323 | None |
| D8UVC8 | 3-135 | None |
| A0A0C9UHP7 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.