DPCstruct | MC59334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 974 |
|---|---|
| Mean domain length (aa) | 209 ± 43 aa |
| Standard deviation of domain lengths | 43.21 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.04 |
| Pfam Score | 96.25 |
| Assigned Pfam label(s) | PF01915- PF08352- PF19300- PF12911- CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q8LA50 | 9-213 | LQILPRLLEGALVTIQATLGGMAFAVIGGLLLVIARLSRFAIVRYPAAFFVEFVRSTPLVIQLFLVFYVFPRYGVVLSPFVAGVLAL… |
| A0A381Y3B2 | 280-504 | DISQLLSDSFLYMKDVLGRMWPPDFSNFSHLMLAMLETVEIAMLGTLLAITLSIPIGLLSARNIAPNYPIYLIARTITVFFRAIPEF… |
| A0A0B8PJ48 | 15-170 | None |
| A0A3M1B9L0 | 631-852 | None |
| A0A3C0MTL0 | 7-170 | None |
| A0A084U4B5 | 50-315 | None |
| A0A7W0PY74 | 3-144 | None |
| A9WNV2 | 4-212 | None |
| A0A3T0K6U7 | 902-1170 | None |
| A0A833NWA8 | 370-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.